LRRC55 (NM_001005210) Human Mass Spec Standard

CAT#: PH321563

LRRC55 MS Standard C13 and N15-labeled recombinant protein (NP_001005210)

Product Images

Coomassie blue staining of purified LRRC55 protein (Cat# TP321563). The protein was produced from HEK293T cells transfected with LRRC55 cDNA clone (Cat# RC221563) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221563
• Predicted MW: 37.5 kDa
• Protein Sequence:
  Sequence Link

  >RC221563 representing NM_001005210
  Red=Cloning site Green=Tags(s)
  
  MLRSPTFTDAGPRCSCLPVSQTLDSMDTVLMGSLQHCCCLLPKMGDTWAQLPWPGPPHPAMLLISLLLAA
  GLMHSDAGTSCPVLCTCRNQVVDCSSQRLFSVPPDLPMDTRNLSLAHNRITAVPPGYLTCYMELQVLDLH
  NNSLMELPRGLFLHAKRLAHLDLSYNNFSHVPADMFQEAHGLVHIDLSHNPWLRRVHPQAFQGLMQLRDL
  DLSYGGLAFLSLEALEGLPGLVTLQIGGNPWVCGCTMEPLLKWLRNRIQRCTADSQLAECRGPPEVEGAP
  LFSLTEESFKACHLTLTLDDYLFIAFVGFVVSIASVATNFLLGITANCCHRWSKASEEEEI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001005210
• RefSeq Size: 3797
• RefSeq ORF: 1023
• Locus ID: 219527
• UniProt ID: Q6ZSA7, A0A494C0H1
• Cytogenetics: 11q12.1
• Protein Families: Transmembrane