BRN4 (POU3F4) (NM_000307) Human Mass Spec Standard

CAT#: PH321645

POU3F4 MS Standard C13 and N15-labeled recombinant protein (NP_000298)

Product Images

Coomassie blue staining of purified POU3F4 protein (Cat# TP321645). The protein was produced from HEK293T cells transfected with POU3F4 cDNA clone (Cat# RC221645) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221645
• Predicted MW: 39.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221645 representing NM_000307
  Red=Cloning site Green=Tags(s)
  
  MATAASNPYSILSSTSLVHADSAGMQQGSPFRNPQKLLQSDYLQGVPSNGHPLGHHWVTSLSDGGPWSST
  LATSPLDQQDVKPGREDLQLGAIIHHRSPHVAHHSPHTNHPNAWGASPAPNPSITSSGQPLNVYSQPGFT
  VSGMLEHGGLTPPPAAASAQSLHPVLREPPDHGELGSHHCQDHSDEETPTSDELEQFAKQFKQRRIKLGF
  TQADVGLALGTLYGNVFSQTTICRFEGLQLSFKNMCKLKPLLNKWLEEADSSTGSPTSIDKIAAQGRKRK
  KRTSIEVSVKGVLETHFLKCPKPAAQEISSLADSLQLEKEVVRVWFCNRRQKEKRMTPPGDQQPHEVYSH
  TVKTDTSCHDL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000298
• RefSeq Size: 1481
• RefSeq ORF: 1083
• Synonyms: BRAIN-4; BRN-4; BRN4; DFN3; DFNX2; OCT-9; OTF-9; OTF9
• Locus ID: 5456
• UniProt ID: P49335, A0A2R8Y739
• Cytogenetics: Xq21.1
• Summary: 'This gene encodes a member of the POU-III class of neural transcription factors. This family member plays a role in inner ear development. The protein is thought to be involved in the mediation of epigenetic signals which induce striatal neuron-precursor differentiation. Mutations in this gene are associated with X chromosome-linked nonsyndromic mixed deafness. [provided by RefSeq, Dec 2012]'
• Protein Families: Druggable Genome, Transcription Factors