CLEC2D (NM_001004419) Human Mass Spec Standard

CAT#: PH321680

CLEC2D MS Standard C13 and N15-labeled recombinant protein (NP_001004419)

Product Images

Coomassie blue staining of purified CLEC2D protein (Cat# TP321680). The protein was produced from HEK293T cells transfected with CLEC2D cDNA clone (Cat# RC221680) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221680
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC221680 representing NM_001004419
  Red=Cloning site Green=Tags(s)
  
  MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC
  LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG
  QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001004419
• RefSeq Size: 1821
• RefSeq ORF: 582
• Synonyms: CLAX; LLT1; OCIL
• Locus ID: 29121
• UniProt ID: Q9UHP7
• Cytogenetics: 12p13.31
• Summary: This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
• Protein Families: Druggable Genome, Transmembrane