NHP2L1 (SNU13) (NM_001003796) Human Mass Spec Standard
CAT#: PH321735
NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003796)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221735 |
Predicted MW | 14.2 kDa |
Protein Sequence |
>RC221735 protein sequence
Red=Cloning site Green=Tags(s) MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLP LLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001003796 |
RefSeq Size | 1520 |
RefSeq ORF | 384 |
Synonyms | 15.5K; FA-1; FA1; NHP2L1; NHPX; OTK27; SNRNP15-5; SPAG12; SSFA1 |
Locus ID | 4809 |
UniProt ID | P55769, Q6FHM6 |
Cytogenetics | 22q13.2 |
Summary | 'Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008]' |
Protein Pathways | Spliceosome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417581 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC424011 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY417581 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1 |
USD 396.00 |
|
LY424011 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
USD 396.00 |
|
PH324143 | NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_004999) |
USD 2,055.00 |
|
TP321735 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
USD 748.00 |
|
TP324143 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1 |
USD 748.00 |
|
TP720213 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review