ART5 (NM_001079536) Human Mass Spec Standard

CAT#: PH321774

ART5 MS Standard C13 and N15-labeled recombinant protein (NP_001073004)

Product Images

Coomassie blue staining of purified ART5 protein (Cat# TP321774). The protein was produced from HEK293T cells transfected with ART5 cDNA clone (Cat# RC221774) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221774
• Predicted MW: 32.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221774 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALAALMIALGSLGLHTWQAQAVPTILPLGLAPDTFDDTYVGCVEEMEEKAAPLLKEEMAHHALLRESWE
  AAQETWEDKRRGLTLPPGFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIR
  ALQLLRGSGGCSRGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAP
  IQAFSVFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTG
  DLHMTKRHLQQP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001073004
• RefSeq Size: 1249
• RefSeq ORF: 876
• Synonyms: ARTC5
• Locus ID: 116969
• UniProt ID: Q96L15
• Cytogenetics: 11p15.4
• Summary: The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Several transcripts encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
• Protein Families: Secreted Protein