MID1IP1 (NM_001098791) Human Mass Spec Standard

CAT#: PH321845

MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261)

Product Images

Coomassie blue staining of purified MID1IP1 protein (Cat# TP321845). The protein was produced from HEK293T cells transfected with MID1IP1 cDNA clone (Cat# RC221845) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC221845
• Predicted MW: 20.2 kDa
• Protein Sequence:
  Sequence Link

  >RC221845 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV
  PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
  EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001092261
• RefSeq Size: 1916
• RefSeq ORF: 549
• Synonyms: G12-like; MIG12; S14R; STRAIT11499; THRSPL
• Locus ID: 58526
• UniProt ID: Q9NPA3
• Cytogenetics: Xp11.4