Uroplakin II (UPK2) (NM_006760) Human Mass Spec Standard

CAT#: PH323168

UPK2 MS Standard C13 and N15-labeled recombinant protein (NP_006751)

Product Images

Coomassie blue staining of purified UPK2 protein (Cat# TP323168). The protein was produced from HEK293T cells transfected with UPK2 cDNA clone (Cat# RC223168) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223168
• Predicted MW: 19.4 kDa
• Protein Sequence:
  Sequence Link

  >RC223168 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAPLLPIRTLPLILILLALLSPGAADFNISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKV
  VTSSFVVPPCRGRRELVSVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPR
  RNMESIGLGMARTGGMVVITVLLSVAMFLLVLGFIIALALGSRK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006751
• RefSeq Size: 947
• RefSeq ORF: 552
• Synonyms: UP2; UPII
• Locus ID: 7379
• UniProt ID: O00526
• Cytogenetics: 11q23.3
• Summary: 'This gene encodes one of the proteins of the highly conserved urothelium-specific integral membrane proteins of the asymmetric unit membrane which forms urothelium apical plaques in mammals. The asymmetric unit membrane is believed to strengthen the urothelium by preventing cell rupture during bladder distention. The encoded protein is expressed in the peripheral blood of bladder cancer patients with transitional cell carcinomas.[provided by RefSeq, Sep 2009]'
• Protein Families: Transmembrane