PRLH (NM_015893) Human Mass Spec Standard

CAT#: PH323400

PRLH MS Standard C13 and N15-labeled recombinant protein (NP_056977)

Product Images

Coomassie blue staining of purified PRLH protein (Cat# TP323400). The protein was produced from HEK293T cells transfected with PRLH cDNA clone (Cat# RC223400) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223400
• Predicted MW: 9.6 kDa
• Protein Sequence:
  Sequence Link

  >RC223400 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MKVLRAWLLCLLMLGLALRGAASRTHRHSMEIRTPDINPAWYASRGIRPVGRFGRRRATLGDVPKPGLRP
  RLTCFPLEGGAMSSQDG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056977
• RefSeq Size: 264
• RefSeq ORF: 263
• Synonyms: PRH; PRRP
• Locus ID: 51052
• UniProt ID: P81277, Q53QV7
• Cytogenetics: 2q37.3
• Summary: Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein, Transmembrane