ACCN5 (ASIC5) (NM_017419) Human Mass Spec Standard

CAT#: PH323871

ACCN5 MS Standard C13 and N15-labeled recombinant protein (NP_059115)

Product Images

Coomassie blue staining of purified ASIC5 protein (Cat# TP323871). The protein was produced from HEK293T cells transfected with ASIC5 cDNA clone (Cat# RC223871) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC223871
• Predicted MW: 57.3 kDa
• Protein Sequence:
  Sequence Link

  >RC223871 representing NM_017419
  Red=Cloning site Green=Tags(s)
  
  MEQTEKSKVYAENGLLEKIKLCPSKKPLPSPTERKKFDYDFAISTSFHGIHNIVQNRSKIRRVLWLVVVL
  GSVSLVTWQIYIRLLNYFTWPTTASIEVQYVEKMEFPTVTFCNLNRFQTDAVAKFGVIFFLWHIVSKVLH
  LQEITANSTGSREATDFAASHQNFSIVEFIRNKGFYLNNSTLLDCEFFGKPCSPKDFAHVFTEYGNCFTF
  NHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVDAGIIFVIHSPKKVPQFDGLGLLSPVGMHAR
  VTIRQVKTVHQEYPWGECNPNIKLQNFSSYSTSGCLKECKAQHIKKQCGCVPFLLPGYGIECDLQKYFSC
  VSPVLDHIEFKDLCTVGTHNSSCPVSCEEIEYPATISYSSFPSQKALKYLSKKLNQSRKYIRENLVKIEI
  NYSDLNYKITQQQKAVSVSELLADLGGQLGLFCGASLITIIEIIEYLFTNFYWICIFFLLKISEMTQWTP
  PPQNHLGNKNRIEEC
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059115
• RefSeq Size: 1692
• RefSeq ORF: 1515
• Synonyms: ACCN5; HINAC; INAC
• Locus ID: 51802
• UniProt ID: Q9NY37
• Cytogenetics: 4q32.1
• Summary: This gene belongs to the amiloride-sensitive Na+ channel and degenerin (NaC/DEG) family, members of which have been identified in many animal species ranging from the nematode to human. The amiloride-sensitive Na(+) channel encoded by this gene is primarily expressed in the small intestine, however, its exact function is not known. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Ion Channels: Other, Transmembrane