GNAT3 (NM_001102386) Human Mass Spec Standard

CAT#: PH324201

GNAT3 MS Standard C13 and N15-labeled recombinant protein (NP_001095856)

Product Images

Coomassie blue staining of purified GNAT3 protein (Cat# TP324201). The protein was produced from HEK293T cells transfected with GNAT3 cDNA clone (Cat# RC224201) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224201
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC224201 representing NM_001102386
  Red=Cloning site Green=Tags(s)
  
  MGSGISSESKESAKRSKELEKKLQEDAERDARTVKLLLLGAGESGKSTIVKQMKIIHKNGYSEQECMEFK
  AVIYSNTLQSILAIVKAMTTLGIDYVNPRSAEDQRQLYAMANTLEDGGMTPQLAEVIKRLWRDPGIQACF
  ERASEYQLNDSAAYYLNDLDRITASGYVPNEQDVLHSRVKTTGIIETQFSFKDLHFRMFDVGGQRSERKK
  WIHCFEGVTCIIFCAALSAYDMVLVEDEEVNRMHESLHLFNSICNHKYFSTTSIVLFLNKKDIFQEKVTK
  VHLSICFPEYTGPNTFEDAGNYIKNQFLDLNLKKEDKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKD
  CGLF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001095856
• RefSeq Size: 1065
• RefSeq ORF: 1062
• Synonyms: GDCA
• Locus ID: 346562
• UniProt ID: A8MTJ3
• Cytogenetics: 7q21.11
• Summary: Sweet, bitter, and umami tastes are transmitted from taste receptors by a specific guanine nucleotide binding protein. The protein encoded by this gene is the alpha subunit of this heterotrimeric G protein, which is found not only in the oral epithelium but also in gut tissues. Variations in this gene have been linked to metabolic syndrome. [provided by RefSeq, Dec 2015]
• Protein Pathways: Taste transduction