UBE2S (NM_014501) Human Mass Spec Standard

CAT#: PH324851

UBE2S MS Standard C13 and N15-labeled recombinant protein (NP_055316)

Product Images

Coomassie blue staining of purified UBE2S protein (Cat# TP324851). The protein was produced from HEK293T cells transfected with UBE2S cDNA clone (Cat# RC224851) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224851
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC224851 representing NM_014501
  Red=Cloning site Green=Tags(s)
  
  MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLFRMKLLLGKDF
  PASPPKGYFLTKIFHPNVGANGEICVNVLKRDWTAELGIRHVLLTIKCLLIHPNPESALNEEAGRLLLEN
  YEEYAARARLLTEIHGGAGGPSGRAEAGRALASGTEASSTDPGAPGGPGGAEGPMAKKHAGERDKKLAAK
  KKTDKKRALRRL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055316
• RefSeq Size: 890
• RefSeq ORF: 1082
• Synonyms: E2-EPF; E2EPF; EPF5
• Locus ID: 27338
• UniProt ID: Q16763
• Cytogenetics: 19q13.42
• Summary: This gene encodes a member of the ubiquitin-conjugating enzyme family. The encoded protein is able to form a thiol ester linkage with ubiquitin in a ubiquitin activating enzyme-dependent manner, a characteristic property of ubiquitin carrier proteins. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Ubiquitin mediated proteolysis