Sialoadhesin (SIGLEC1) (NM_023068) Human Mass Spec Standard

CAT#: PH324969

SIGLEC1 MS Standard C13 and N15-labeled recombinant protein (NP_075556)

Product Images

Coomassie blue staining of purified SIGLEC1 protein (Cat# TP324969). The protein was produced from HEK293T cells transfected with SIGLEC1 cDNA clone (Cat# RC224969) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC224969
• Predicted MW: 180.6 kDa
• Protein Sequence:
  Sequence Link

  >RC224969 representing NM_023068
  Red=Cloning site Green=Tags(s)
  
  MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWYYDYSGQRQVV
  SHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEISEVNRWSDVKGTLVTVTEEPR
  VPTIASPVEL
  
  LEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075556
• RefSeq Size: 5130
• RefSeq ORF: 5127
• Synonyms: CD169; SIGLEC-1; SN
• Locus ID: 6614
• UniProt ID: Q9BZZ2
• Cytogenetics: 20p13
• Summary: 'This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a lectin-like adhesion molecule that binds glycoconjugate ligands on cell surfaces in a sialic acid-dependent manner. It is a type I transmembrane protein expressed only by a subpopulation of macrophages and is involved in mediating cell-cell interactions. Alternative splicing produces a transcript variant encoding an isoform that is soluble rather than membrane-bound; however, the full-length nature of this variant has not been determined. [provided by RefSeq, Jul 2008]'
• Protein Families: Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs)