HCCS (NM_001122608) Human Mass Spec Standard
CAT#: PH325362
HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC225362 |
Predicted MW | 30.4 kDa |
Protein Sequence |
>RC225362 representing NM_001122608
Red=Cloning site Green=Tags(s) MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001116080 |
RefSeq ORF | 804 |
Synonyms | CCHL; LSDMCA1; MCOPS7; MLS |
Locus ID | 3052 |
UniProt ID | P53701, A0A024RBY9 |
Cytogenetics | Xp22.2 |
Summary | 'The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]' |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC426535 | HCCS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY426535 | Transient overexpression lysate of holocytochrome c synthase (cytochrome c heme-lyase) (HCCS), transcript variant 2 |
USD 396.00 |
|
TP325362 | Recombinant protein of human holocytochrome c synthase (cytochrome c heme-lyase) (HCCS) |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review