HCCS (NM_001122608) Human Mass Spec Standard

CAT#: PH325362

HCCS MS Standard C13 and N15-labeled recombinant protein (NP_001116080)

Product Images

Coomassie blue staining of purified HCCS protein (Cat# TP325362). The protein was produced from HEK293T cells transfected with HCCS cDNA clone (Cat# RC225362) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225362
• Predicted MW: 30.4 kDa
• Protein Sequence:
  Sequence Link

  >RC225362 representing NM_001122608
  Red=Cloning site Green=Tags(s)
  
  MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRG
  TAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDE
  DISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDR
  HDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001116080
• RefSeq ORF: 804
• Synonyms: CCHL; LSDMCA1; MCOPS7; MLS
• Locus ID: 3052
• UniProt ID: P53701, A0A024RBY9
• Cytogenetics: Xp22.2
• Summary: 'The protein encoded by this gene is an enzyme that covalently links a heme group to the apoprotein of cytochrome c. Defects in this gene are a cause of microphthalmia syndromic type 7 (MCOPS7). Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jan 2010]'
• Protein Pathways: Porphyrin and chlorophyll metabolism