NAPE PLD (NAPEPLD) (NM_001122838) Human Mass Spec Standard

CAT#: PH325603

NAPEPLD MS Standard C13 and N15-labeled recombinant protein (NP_001116310)

Product Images

Coomassie blue staining of purified NAPEPLD protein (Cat# TP325603). The protein was produced from HEK293T cells transfected with NAPEPLD cDNA clone (Cat# RC225603) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225603
• Predicted MW: 45.4 kDa
• Protein Sequence:
  Sequence Link

  >RC225603 representing NM_001122838
  Red=Cloning site Green=Tags(s)
  
  MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKGKDGRFVNPWP
  TWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGVREAGLRVTWLGHATVMVEMD
  ELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDAVLISHNHYDHLDYNSVIALNERFGNELRWF
  VPLGLLDWMQKCGCENVIELDWWEENCVPGHDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFF
  FAGDTGYCPAFEEIGKRFGPFDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALA
  NEHYLEPPVKLNEALERYGLNAEDFFVLKHGESRYLNNDDENF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001116310
• RefSeq ORF: 1179
• Synonyms: C7orf18; FMP30; NAPE-PLD
• Locus ID: 222236
• UniProt ID: Q6IQ20
• Cytogenetics: 7q22.1
• Summary: NAPEPLD is a phospholipase D type enzyme that catalyzes the release of N-acylethanolamine (NAE) from N-acyl-phosphatidylethanolamine (NAPE) in the second step of the biosynthesis of N-acylethanolamine (Okamoto et al., 2004 [PubMed 14634025]). [supplied by OMIM, Oct 2008]