RAB34 (NM_001144943) Human Mass Spec Standard

CAT#: PH326508

RAB34 MS Standard C13 and N15-labeled recombinant protein (NP_001138415)

Product Images

Coomassie blue staining of purified RAB34 protein (Cat# TP326508). The protein was produced from HEK293T cells transfected with RAB34 cDNA clone (Cat# RC226508) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC226508
• Predicted MW: 35 kDa
• Protein Sequence:
  Sequence Link

  >RC226508 representing NM_001144943
  Red=Cloning site Green=Tags(s)
  
  MSHLPGLELRREAPPLLGPLLSPFPLPAGSWHRQMLRSSLRFPITNSAGAPCKAAGRMNILAPVRRDRVL
  AELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKA
  TIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKE
  NDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLA
  ELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001138415
• RefSeq ORF: 948
• Synonyms: NARR; RAB39; RAH
• Locus ID: 83871
• UniProt ID: B4DNC0
• Cytogenetics: 17q11.2
• Summary: This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame. [provided by RefSeq, Dec 2016]
• Protein Families: Druggable Genome