TSH Receptor (TSHR) (NM_001142626) Human Mass Spec Standard
CAT#: PH326653
TSHR MS Standard C13 and N15-labeled recombinant protein (NP_001136098)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226653 |
Predicted MW | 30.8 kDa |
Protein Sequence |
>RC226653 representing NM_001142626
Red=Cloning site Green=Tags(s) MRPADLLQLVLLLDLPRDLGGMGCSSPPCECHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSH AFSNLPNISRIYVSIDVTLQQLESHSFYNLSKVTHIEIRNTRNLTYIDPDALKELPLLKFLGIFNTGLKM FPDLTKVYSTDIFFILEITDNPYMTSIPVNAFQGLCNETLTLKLYNNGFTSVQGYAFNGTKLDAVYLNKN KYLTVIDKDAFGGVYSGPSLLVENVAVSGKGFCKSLFSWLYRLPLGRKSLSFETQKAPRSSMPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001136098 |
RefSeq ORF | 822 |
Synonyms | CHNG1; hTSHR-I; LGR3 |
Locus ID | 7253 |
UniProt ID | P16473 |
Cytogenetics | 14q31.1 |
Summary | 'The protein encoded by this gene is a membrane protein and a major controller of thyroid cell metabolism. The encoded protein is a receptor for thyrothropin and thyrostimulin, and its activity is mediated by adenylate cyclase. Defects in this gene are a cause of several types of hyperthyroidism. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2008]' |
Protein Families | Druggable Genome, GPCR, Transmembrane |
Protein Pathways | Autoimmune thyroid disease, Neuroactive ligand-receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400133 | TSHR HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY400133 | Transient overexpression lysate of thyroid stimulating hormone receptor (TSHR), transcript variant 1 |
USD 605.00 |
|
TP326653 | Purified recombinant protein of Homo sapiens thyroid stimulating hormone receptor (TSHR), transcript variant 3 |
USD 788.00 |
{0} Product Review(s)
Be the first one to submit a review