SLC30A7 (NM_001144884) Human Mass Spec Standard
CAT#: PH327524
SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_001138356)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227524 |
Predicted MW | 41.4 kDa |
Protein Sequence |
>RC227524 representing NM_001144884
Red=Cloning site Green=Tags(s) MLPLSIKDDEYKPPKFNLFGKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSNCLGLISDSFH MFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAFFIFSEGVERALAPPDVHHER LLLVSILGFVVNLIGIFVFKHGGHGHSHGSGHGHSHSLFNGALDQAHGHVDHCHSHEVKHGAAHSHDHAH GHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSIGVIASAIMMQNFGLMIADPICSILIAILIVV SVIPLLRESVGILMQRTPPLLENSLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLIVAPDADARW ILSQTHNIFTQAGVRQLYVQIDFAAM myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001138356 |
RefSeq ORF | 1128 |
Synonyms | ZnT-7; ZNT7; ZnTL2 |
Locus ID | 148867 |
UniProt ID | Q8NEW0 |
Cytogenetics | 1p21.2 |
Summary | Zinc functions as a cofactor for numerous enzymes, nuclear factors, and hormones and as an intra- and intercellular signal ion. Members of the zinc transporter (ZNT)/SLC30 subfamily of the cation diffusion facilitator family, such as SLC30A7, permit cellular efflux of zinc (Seve et al., 2004 [PubMed 15154973]). [supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408825 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428544 | SLC30A7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408825 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 |
USD 396.00 |
|
LY428544 | Transient overexpression lysate of solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2 |
USD 396.00 |
|
PH309198 | SLC30A7 MS Standard C13 and N15-labeled recombinant protein (NP_598003) |
USD 2,055.00 |
|
TP309198 | Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 1 |
USD 823.00 |
|
TP327524 | Recombinant protein of human solute carrier family 30 (zinc transporter), member 7 (SLC30A7), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review