PNCK (NM_001135740) Human Mass Spec Standard

CAT#: PH327807

PNCK MS Standard C13 and N15-labeled recombinant protein (NP_001129212)

Product Images

Coomassie blue staining of purified PNCK protein (Cat# TP327807). The protein was produced from HEK293T cells transfected with PNCK cDNA clone (Cat# RC227807) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC227807
• Predicted MW: 40.2 kDa
• Protein Sequence:
  Sequence Link

  >RC227807 representing NM_001135740
  Red=Cloning site Green=Tags(s)
  
  MWRRVCGGLAGRRPSGDMLLLKKHTEDISSVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKALRG
  KEALVENEIAVLRRISHPNIVALEDVHESPSHLYLAMELVTGGELFDRIMERGSYTEKDASHLVGQVLGA
  VSYLHSLGIVHRDLKPENLLYATPFEDSKIMVSDFGLSKIQAGNMLGTACGTPGYVAPELLEQKPYGKAV
  DVWALGVISYILLCGYPPFYDESDPELFSQILRASYEFDSPFWDDISESAKDFIRHLLERDPQKRFTCQQ
  ALRHLWISGDTAFDRDILGSVSEQIRKNFARTHWKRAFNATSFLRHIRKLGQIPEGEGASEQGMARHSHS
  GLRAGQPPKW
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001129212
• RefSeq ORF: 1080
• Synonyms: BSTK3; CaMK1b
• Locus ID: 139728
• UniProt ID: Q6P2M8
• Cytogenetics: Xq28
• Summary: PNCK is a member of the calcium/calmodulin-dependent protein kinase family of protein serine/threonine kinases (see CAMK1; MIM 604998) (Gardner et al., 2000 [PubMed 10673339]). [supplied by OMIM, Mar 2008]
• Protein Families: Druggable Genome, Protein Kinase