PDCD10 (His-tag) Human Protein
Other products for "PDCD10"
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARLKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
|
Tag | His-tag |
Predicted MW | 26.7 kDa |
Purity | >95% by SDS-PAGE and silver stain |
Buffer | Presentation State: Purified State: Lyophilized protein Buffer System: PBS Stabilizer: None |
Endotoxin | < 0.1 ng/µg of CCM-3 |
Reconstitution | The lyophilized protein is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50 μg/ml. |
Preparation | Lyophilized protein |
Protein Description | Human recombinant PDCD10 fragment, aa. 231 |
Note | Protein RefSeq: NP_009148.2 mRNA RefSeq: NM_007217.3 |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_009148 |
Locus ID | 11235 |
UniProt ID | Q9BUL8 |
Cytogenetics | 3q26.1 |
Synonyms | CCM3; TFAR15 |
Summary | This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.