PDCD10 (His-tag) Human Protein

CAT#: AR26004PU-N

PDCD10 (His-tag) human recombinant protein, 20 µg


USD 210.00

2 Weeks*

Size
    • 20 ug

Product Images

Other products for "PDCD10"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGSSHHHHHHSSGLVPRGSMRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLRAAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLNEKARLKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Tag His-tag
Predicted MW 26.7 kDa
Purity >95% by SDS-PAGE and silver stain
Buffer Presentation State: Purified
State: Lyophilized protein
Buffer System: PBS
Stabilizer: None
Endotoxin < 0.1 ng/µg of CCM-3
Reconstitution The lyophilized protein is soluble in water and most aqueous buffers and should be reconstituted in PBS or medium containing at least 0.1% human or bovine serum albumin to a concentration not lower than 50 μg/ml.
Preparation Lyophilized protein
Protein Description Human recombinant PDCD10 fragment, aa. 231
Note Protein RefSeq: NP_009148.2
mRNA RefSeq: NM_007217.3
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_009148
Locus ID 11235
UniProt ID Q9BUL8
Cytogenetics 3q26.1
Synonyms CCM3; TFAR15
Summary This gene encodes an evolutionarily conserved protein associated with cell apoptosis. The protein interacts with the serine/threonine protein kinase MST4 to modulate the extracellular signal-regulated kinase (ERK) pathway. It also interacts with and is phosphoryated by serine/threonine kinase 25, and is thought to function in a signaling pathway essential for vascular developent. Mutations in this gene are one cause of cerebral cavernous malformations, which are vascular malformations that cause seizures and cerebral hemorrhages. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.