Podoplanin Rat Protein

CAT#: AR31059PU-N

Podoplanin rat recombinant protein, 5 µg

Product Images

Specifications

Product Data

• Species: Rat
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  GAIGALEDDLVTPGPGDDMVNPGLEDRIETTDTTGELDKSTAKAPLVPTQPPIEELPTSGTSDHDHKEHESTTTVKAVTSHSTDKKTTHPNRDNAGGETQTTDKKDGLAVVTLEHHHHHH
  N-terminal sequence: GAIGALED
• Predicted MW: 12.8 kDa
• Purity: >98%
• Buffer: Presentation State: Purified
  State: Lyophilized purified protein.
  Buffer System: 0.5x PBS without stabilizer
• Endotoxin: < 0.1ng per µg of Rat soluble Podoplanin
• Reconstitution: We recommend a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
  This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
• Preparation: Lyophilized purified protein.
• Protein Description: Recombinant Rat soluble Podoplanin
• Storage: The lyophilized protein is stable for a few weeks at room temperature, but best stored at –20°C.
  Reconstituted soluble Podoplanin should be stored in working aliquots at –20°C.
  Avoid repeated freeze-thaw cycles.
• Stability: Stable for at least 3 months from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_062231
• Locus ID: 54320
• UniProt ID: Q64294
• Cytogenetics: 5q36
• Synonyms: E11; Gp38; OTS-8; RTI40; T1-alpha
• Summary: membrane glycoprotein that may function in lung development [RGD, Feb 2006]