CD70 Human Protein
Product Images
Other products for "CD70"
Specifications
Product Data | |
Species | Human |
Expression Host | CHO |
Expression cDNA Clone or AA Sequence |
HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP
|
Predicted MW | 18.8 kDa |
Purity | >95% by SDS-PAGE & HPLC analysis |
Buffer | Presentation State: Purified State: Lyophilized purified protein Buffer System: PBS without stabilizers |
Bioactivity | Biological: Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml. Note: Results may vary with PBMC donors. |
Reconstitution | We recommended a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml. This solution can be diluted into other aqueous buffers and stored at 4°C for one week or at –20°C for future use. |
Preparation | Lyophilized purified protein |
Protein Description | Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag. |
Note | Centrifuge vials before opening! |
Storage | Store lyophilized at 2-8°C for 6 months or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for one month or (in aliquots) at -20°C long term. Avoid repeated freezing and thawing. |
Stability | Shelf life: one year from despatch. |
Reference Data | |
RefSeq | NP_001243 |
Locus ID | 970 |
UniProt ID | P32970, A0A0U5JA32 |
Cytogenetics | 19p13.3 |
Synonyms | CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A |
Summary | 'The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]' |
Protein Families | ES Cell Differentiation/IPS, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
Resources
Recombinant Protein Resources |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.