CD70 Human Protein

CAT#: AR31159PU-N

CD70 human protein, 50 µg


USD 340.00

2 Weeks*

Size
    • 50 ug

Product Images

Other products for "CD70"

Specifications

Product Data
Species Human
Expression Host CHO
Expression cDNA Clone or AA Sequence
HHHHHHHHPSPGGSGGQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPR LYWQGGPALGRSFLHGPELDKGQLRIHRDGIYMVHIQVTLAICSSTTASR HHPTTLAVGICSPASRSISLLRLSFHQGCTIASQRLTPLARGDTLCTNLT GTLLPSRNTDETFFGVQWVRP
Predicted MW 18.8 kDa
Purity >95% by SDS-PAGE & HPLC analysis
Buffer Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS without stabilizers
Bioactivity Biological: Determined by its ability to stimulate human IL-8 production by human PBMC using a concentration range of 10.0-25.0 ng/ml.
Note: Results may vary with PBMC donors.
Reconstitution We recommended a quick spin followed by reconstitution in water to a concentration of 0.1-1.0 mg/ml.
This solution can be diluted into other aqueous buffers and stored at 4°C for one week or at –20°C for future use.
Preparation Lyophilized purified protein
Protein Description Human soluble CD27L corresponds to the 155 amino acid extracellular domain of the full length CD27L protein. The provided human sCD27L protein contains the extracellular domain plus an N-terminal His-Tag.
Note Centrifuge vials before opening!
Storage Store lyophilized at 2-8°C for 6 months or at -20°C long term.
After reconstitution store the antibody undiluted at 2-8°C for one month 
or (in aliquots) at -20°C long term.
Avoid repeated freezing and thawing.
Stability Shelf life: one year from despatch.
Reference Data
RefSeq NP_001243
Locus ID 970
UniProt ID P32970, A0A0U5JA32
Cytogenetics 19p13.3
Synonyms CD27-L; CD27L; CD27LG; LPFS3; TNFSF7; TNLG8A
Summary 'The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis. [provided by RefSeq, Jul 2008]'
Protein Families ES Cell Differentiation/IPS, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction

Documents

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.