Endomucin (His-tag) Human Protein

CAT#: AR31181PU-N

Endomucin (His-tag) human recombinant protein, 20 µg

Product Images

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MGSSHHHHHHSSGLVPRGSHMGSHMNSTGVLEAANNSLVVTTTKPSITTPNTESLQKNVVTPTTGTTPKGTITNELLKMSLMSTATFLTSKDEGLKATTTDVRKNDSIISNVTVTSVTLPNAVSTLQSSKPKTETQSSIKTTEIPGSVLQPDASPSKTGTLTSIPVTIPENTSQSQVIGTEGGKNASTSATSRSYSS
• Tag: His-tag
• Predicted MW: ~ 20.4 kDa
• Purity: >95% by SDS-PAGE & Silver staining
• Buffer: Presentation State: Purified
  State: Lyophilized protein
  Buffer System: 10mM NaP, pH 7.0
  Stabilizer: None
• Reconstitution: Restore in water or PBS to a concentration of not lower than 100 μg/ml.
• Preparation: Lyophilized protein
• Protein Description: Recombinant Human soluble Endomucin.
  The sequence corresponds to Asn18 to Ser190. A 6x His-tag is fused to the N-terminal end of the recombinant Human soluble Endomucin.
• Storage: Store lyophilized at 2-8°C for 6 months or at -20°C long term.
  After reconstitution store the antibody undiluted at 2-8°C for one month
  or (in aliquots) at -20°C long term.
  Avoid repeated freezing and thawing.
• Stability: Shelf life: one year from despatch.

Reference Data

• RefSeq: NP_001153166
• Locus ID: 51705
• UniProt ID: Q9ULC0
• Cytogenetics: 4q24
• Synonyms: EMCN2; MUC14
• Summary: EMCN is a mucin-like sialoglycoprotein that interferes with the assembly of focal adhesion complexes and inhibits interaction between cells and the extracellular matrix (Kinoshita et al., 2001 [PubMed 11418125]). [supplied by OMIM, Mar 2008]
• Protein Families: Transmembrane