METTL9 (NM_016025) Human Recombinant Protein
CAT#: TP300028
Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 1
View other "METTL9" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200028 protein sequence
Red=Cloning site Green=Tags(s) MRLLAGWLCLSLASVWLARRMWTLRSPLTRSLYVNMTSGPGGPAAAAGGRKENHQWYVCNREKLCESLQA VFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRTSINGLLGRGSMFVFSPDQFQRLLKI NPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATELSETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLN LLDRCDQPLTLLKDIRSVLEPTRGRVILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVF RKAGFVIEAFTRLPYLCEGDMYNDYYVLDDAVFVLKPV myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.4 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057109 |
Locus ID | 51108 |
UniProt ID | Q9H1A3 |
Cytogenetics | 16p12.2 |
Refseq Size | 3267 |
Refseq ORF | 954 |
Synonyms | CGI-81; DREV; DREV1; PAP1 |
Summary | Protein-histidine N-methyltransferase that specifically catalyzes 1-methylhistidine (pros-methylhistidine) methylation of target proteins (PubMed:33563959). Mediates methylation of proteins with a His-x-His (HxH) motif (where 'x' is preferably a small amino acid) (PubMed:33563959). Catalyzes methylation of target proteins such as S100A9, NDUFB3, SLC39A5, SLC39A7, ARMC6 and DNAJB12; 1-methylhistidine modification may affect the binding of zinc and other metals to its target proteins (PubMed:33563959). Constitutes the main methyltransferase for the 1-methylhistidine modification in cell (PubMed:33563959).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414244 | METTL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421369 | METTL9 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY414244 | Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 1 |
USD 396.00 |
|
LY421369 | Transient overexpression lysate of methyltransferase like 9 (METTL9), transcript variant 2 |
USD 396.00 |
|
PH300028 | METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_057109) |
USD 2,055.00 |
|
PH318283 | METTL9 MS Standard C13 and N15-labeled recombinant protein (NP_001070648) |
USD 2,055.00 |
|
TP318283 | Recombinant protein of human methyltransferase like 9 (METTL9), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review