RABL4 (IFT27) (NM_006860) Human Recombinant Protein
CAT#: TP300215
Recombinant protein of human RAB, member of RAS oncogene family-like 4 (RABL4)
View other "IFT27" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200215 protein sequence
Red=Cloning site Green=Tags(s) MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKEL FSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARA WALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006851 |
Locus ID | 11020 |
UniProt ID | Q9BW83 |
Cytogenetics | 22q12.3 |
Refseq Size | 1101 |
Refseq ORF | 558 |
Synonyms | BBS19; FAP156; RABL4; RAYL |
Summary | This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416367 | IFT27 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416367 | Transient overexpression lysate of RAB, member of RAS oncogene family-like 4 (RABL4) |
USD 396.00 |
|
PH300215 | RABL4 MS Standard C13 and N15-labeled recombinant protein (NP_006851) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review