TMEM14B (NM_030969) Human Recombinant Protein

CAT#: TP300239

Recombinant protein of human transmembrane protein 14B (TMEM14B), transcript variant 1


  View other "TMEM14B" proteins (3)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

4 Weeks*

Size
    • 20 ug

Product Images

Frequently bought together (1)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "TMEM14B"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC200239 protein sequence
Red=Cloning site Green=Tags(s)

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAWLLFGSLAGLGAYQLYQDPRNVWGFLAAT
SVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 11.9 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_112231
Locus ID 81853
UniProt ID Q9NUH8, A0A024QZV7
Cytogenetics 6p24.2
Refseq Size 992
Refseq ORF 342
Summary Primate-specific protein involved in cortical expansion and folding in the developing neocortex. May drive neural progenitor proliferation through nuclear translocation of IQGAP1, which in turn promotes G1/S cell cycle transitions.[UniProtKB/Swiss-Prot Function]
Protein Families Transmembrane

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.