CRTAP (NM_006371) Human Recombinant Protein
CAT#: TP300555
Recombinant protein of human cartilage associated protein (CRTAP)
View other "CRTAP" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 415.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200555 protein sequence
Red=Cloning site Green=Tags(s) MEPGRRGAAALLALLCVACALRAGRAQYERYSFRSFPRDELMPLESAYRHALDKYSGEHWAESVGYLEIS LRLHRLLRDSEAFCHRNCSAAPQPEPAAGLASYPELRLFGGLLRRAHCLKRCKQGLPAFRQSQPSRDVLA DFQRREPYKFLQFAYFKANNLPKAIAAAHTFLLKHPDDEMMKRNMAYYKSLPGAEDYIKDLETKSYESLF IRAVRAYNGENWRTSITDMELALPDFFKAFYECLAACEGSREIKDFKDFYLSIADHYVEVLECKIQCEEN LTPVIGGYPVEKFVATMYHYLQFAYYKLNDLKNAAPCAVSYLLFDQNDKVMQQNLVYYQYHRDTWGLSDE HFQPRPEAVQFFNVTTLQKELYDFAKENIMDDDEGEVVEYVDDLLELEETS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006362 |
Locus ID | 10491 |
UniProt ID | O75718 |
Cytogenetics | 3p22.3 |
Refseq Size | 6668 |
Refseq ORF | 1203 |
Synonyms | CASP; LEPREL3; OI7; P3H5 |
Summary | The protein encoded by this gene is similar to the chicken and mouse CRTAP genes. The encoded protein is a scaffolding protein that may influence the activity of at least one member of the cytohesin/ARNO family in response to specific cellular stimuli. Defects in this gene are associated with osteogenesis imperfecta, a connective tissue disorder characterized by bone fragility and low bone mass. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416690 | CRTAP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416690 | Transient overexpression lysate of cartilage associated protein (CRTAP) |
USD 396.00 |
|
PH300555 | CRTAP MS Standard C13 and N15-labeled recombinant protein (NP_006362) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review