TRAPPC3 (NM_014408) Human Recombinant Protein

CAT#: TP300602

Recombinant protein of human trafficking protein particle complex 3 (TRAPPC3)

Product Images

Coomassie blue staining of purified TRAPPC3 protein (Cat# TP300602). The protein was produced from HEK293T cells transfected with TRAPPC3 cDNA clone (Cat# RC200602) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200602 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRQANRGTESKKMSSELFTLTYGALVTQLCKDYENDEDVNKQLDKMGFNIGVRLIEDFLARSNVGRCHD
  FRETADVIAKVAFKMYLGITPSITNWSPAGDEFSLILENNPLVDFVELPDNHSSLIYSNLLCGVLRGALE
  MVQMAVEAKFVQDTLKGDGVTEIRMRFIRRIEDNLPAGEE
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055223
• Locus ID: 27095
• UniProt ID: O43617
• Cytogenetics: 1p34.3
• Refseq Size: 1333
• Refseq ORF: 540
• Synonyms: BET3
• Summary: This gene encodes a component of the trafficking protein particle complex, which tethers transport vesicles to the cis-Golgi membrane. The encoded protein participates in the regulation of transport from the endoplasmic reticulum to the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]