NMNAT2 (NM_170706) Human Recombinant Protein
CAT#: TP300889
Recombinant protein of human nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2
View other "NMNAT2" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200889 protein sequence
Red=Cloning site Green=Tags(s) MEIQELEEIQACQGLWEVFVTLSERARDYLHKTGRFIVIGGIVSPVHDSYGKQGLVSSRHRLIMCQLAVQ NSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTPSMTPVIGQPQNETPQPIYQNSNVAT KPTAAKILGKVGESLSRICCVRPPVERFTFVDENANLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNE ADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVV DYLSQPVIDYILKSQLYINASG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 33.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_733820 |
Locus ID | 23057 |
UniProt ID | Q9BZQ4 |
Cytogenetics | 1q25.3 |
Refseq Size | 5467 |
Refseq ORF | 906 |
Synonyms | C1orf15; PNAT2 |
Summary | This gene product belongs to the nicotinamide mononucleotide adenylyltransferase (NMNAT) enzyme family, members of which catalyze an essential step in NAD (NADP) biosynthetic pathway. Unlike the other human family member, which is localized to the nucleus, and is ubiquitously expressed; this enzyme is cytoplasmic, and is predominantly expressed in the brain. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Pathways | Metabolic pathways, Nicotinate and nicotinamide metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406885 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC414841 | NMNAT2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY406885 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 2 |
USD 396.00 |
|
LY414841 | Transient overexpression lysate of nicotinamide nucleotide adenylyltransferase 2 (NMNAT2), transcript variant 1 |
USD 396.00 |
|
PH300889 | NMNAT2 MS Standard C13 and N15-labeled recombinant protein (NP_733820) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review