RAP1GDS1 (NM_021159) Human Recombinant Protein
CAT#: TP300924
Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2
View other "RAP1GDS1" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200924 protein sequence
Red=Cloning site Green=Tags(s) MADNLSDTLKKLKITAVDKTEDSLEGCLDCLLQALAQNNTETSEKIQASGILQLFATLLTPQSSCKAKVA NIIAEVAKNEFMRIPCVDAGLISPLVQLLNSKDQEVLLQTGRALGNICYDSHEGRSAVDQAGGAQIVIDH LRSLCSITDPANEKLLTVFCGMLMNYSNENDSLQAQLINMGVIPTLVKLLGIHCQNAALTEMCLVAFGNL AELESSKEQFASTNIAEELVKLFKKQIEHDKREMIFEVLAPLAENDAIKLQLVEAGLVECLLEIVQQKVD SDKEDDITELKTGSDLMVLLLLGDESMQKLFEGGKGSVFQRVLSWIPSNNHQLQLAGALAIANFARNDAN CIHMVDNGIVEKLMDLLDRHVEDGNVTVQHAALSALRNLAIPVINKAKMLSAGVTEAVLKFLKSEMPPVQ FKLLGTLRMLIDAQEAAEQLGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKDVIKTIVQSG GIKHLVTMATSEHVIMQNEALVALALIAALELGTAEKDLESAKLVQILHRLLADERSAPEIKYNSMVLIC ALMGSECLHKEVQDLAFLDVVSKLRSHENKSVAQQASLTEQRLTVES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 66.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066982 |
Locus ID | 5910 |
UniProt ID | P52306 |
Cytogenetics | 4q23 |
Refseq Size | 3767 |
Refseq ORF | 1821 |
Synonyms | GDS1; SmgGDS |
Summary | The smg GDP dissociation stimulator (smgGDS) protein is a stimulatory GDP/GTP exchange protein with GTPase activity (Riess et al., 1993 [PubMed 8262526]).[supplied by OMIM, Feb 2010] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412050 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC420266 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC420268 | RAP1GDS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY412050 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 2 |
USD 396.00 |
|
LY420266 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 |
USD 605.00 |
|
LY420268 | Transient overexpression lysate of RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 5 |
USD 605.00 |
|
PH300924 | RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_066982) |
USD 2,055.00 |
|
PH312781 | RAP1GDS1 MS Standard C13 and N15-labeled recombinant protein (NP_001093897) |
USD 2,055.00 |
|
TP312781 | Recombinant protein of human RAP1, GTP-GDP dissociation stimulator 1 (RAP1GDS1), transcript variant 3 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review