p19 INK4d (CDKN2D) (NM_079421) Human Recombinant Protein
CAT#: TP301155
Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2
View other "CDKN2D" proteins (7)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201155 protein sequence
Red=Cloning site Green=Tags(s) MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQ DTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGL TPLELALQRGAQDLVDILQGHMVAPL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_524145 |
Locus ID | 1032 |
UniProt ID | P55273, A0A024R796 |
Cytogenetics | 19p13.2 |
Refseq Size | 1162 |
Refseq ORF | 498 |
Synonyms | INK4D; p19; p19-INK4D |
Summary | The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Cell cycle |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400682 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC409201 | CDKN2D HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY400682 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 |
USD 396.00 |
|
LY409201 | Transient overexpression lysate of cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 2 |
USD 396.00 |
|
PH301155 | CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_524145) |
USD 2,055.00 |
|
PH314065 | CDKN2D MS Standard C13 and N15-labeled recombinant protein (NP_001791) |
USD 2,055.00 |
|
TP314065 | Recombinant protein of human cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) (CDKN2D), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review