TXNL4B (NM_017853) Human Recombinant Protein
CAT#: TP301503
Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 1
View other "TXNL4B" proteins (10)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201503 protein sequence
Red=Cloning site Green=Tags(s) MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYT QYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIP KYDLLYQDI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060323 |
Locus ID | 54957 |
UniProt ID | Q9NX01 |
Cytogenetics | 16q22.2 |
Refseq Size | 2563 |
Refseq ORF | 447 |
Synonyms | Dim2; DLP |
Summary | Essential role in pre-mRNA splicing. Required in cell cycle progression for S/G(2) transition.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413417 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428035 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428036 | TXNL4B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413417 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 1 |
USD 396.00 |
|
LY428035 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 2 |
USD 396.00 |
|
LY428036 | Transient overexpression lysate of thioredoxin-like 4B (TXNL4B), transcript variant 3 |
USD 396.00 |
|
PH301503 | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_060323) |
USD 2,055.00 |
|
PH326616 | TXNL4B MS Standard C13 and N15-labeled recombinant protein (NP_001135790) |
USD 2,055.00 |
|
TP326616 | Recombinant protein of human thioredoxin-like 4B (TXNL4B), transcript variant 3 |
USD 748.00 |
|
TP761241 | Purified recombinant protein of Human thioredoxin-like 4B (TXNL4B), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
USD 215.00 |
{0} Product Review(s)
Be the first one to submit a review