RAB1A (NM_004161) Human Recombinant Protein

CAT#: TP301640

Recombinant protein of human RAB1A, member RAS oncogene family (RAB1A), transcript variant 1

Product Images

Coomassie blue staining of purified RAB1A protein (Cat# TP301640). The protein was produced from HEK293T cells transfected with RAB1A cDNA clone (Cat# RC201640) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201640 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQ
  ERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAK
  EFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004152
• Locus ID: 5861
• UniProt ID: P62820, Q5U0I6
• Cytogenetics: 2p14
• Refseq Size: 2648
• Refseq ORF: 615
• Synonyms: RAB1; YPT1
• Summary: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multiple alternatively spliced transcript variants have been identified for this gene which encode different protein isoforms. [provided by RefSeq, Oct 2008]
• Protein Families: Druggable Genome