MLC1SA (MYL6B) (NM_002475) Human Recombinant Protein

CAT#: TP302076

Recombinant protein of human myosin, light chain 6B, alkali, smooth muscle and non-muscle (MYL6B)

Product Images

Coomassie blue staining of purified MYL6B protein (Cat# TP302076). The protein was produced from HEK293T cells transfected with MYL6B cDNA clone (Cat# RC202076) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202076 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIEFNKDQLEEFK
  EAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSRRVDFETFLPMLQAVAKNRGQ
  GTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEEEVETVLAGHEDSNGCINYEAFLKHILSV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002466
• Locus ID: 140465
• UniProt ID: P14649, A0A024RB31
• Cytogenetics: 12q13.2
• Refseq Size: 1008
• Refseq ORF: 624
• Synonyms: MLC1SA
• Summary: Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. This gene encodes a myosin alkali light chain expressed in both slow-twitch skeletal muscle and in nonmuscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2010]
• Protein Pathways: Vascular smooth muscle contraction