REEP4 (NM_025232) Human Recombinant Protein
CAT#: TP302157
Recombinant protein of human receptor accessory protein 4 (REEP4)
View other "REEP4" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202157 protein sequence
Red=Cloning site Green=Tags(s) MVSWMICRLVVLVFGMLCPAYASYKAVKTKNIREYVRWMMYWIVFALFMAAEIVTDIFISWFPFYYEIKM AFVLWLLSPYTKGASLLYRKFVHPSLSRHEKEIDAYIVQAKERSYETVLSFGKRGLNIAASAAVQAATKS QGALAGRLRSFSMQDLRSISDAPAPAYHDPLYLEDQVSHRRPPIGYRAGGLQDSDTEDECWSDTEAVPRA PARPREKPLIRSQSLRVVKRKPPVREGTSRSLKVRTRKKTVPSDVDS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 29.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_079508 |
Locus ID | 80346 |
UniProt ID | Q9H6H4 |
Cytogenetics | 8p21.3 |
Refseq Size | 1731 |
Refseq ORF | 771 |
Synonyms | C8orf20; PP432; Yip2c |
Summary | Microtubule-binding protein required to ensure proper cell division and nuclear envelope reassembly by sequestering the endoplasmic reticulum away from chromosomes during mitosis. Probably acts by clearing the endoplasmic reticulum membrane from metaphase chromosomes.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410778 | REEP4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410778 | Transient overexpression lysate of receptor accessory protein 4 (REEP4) |
USD 396.00 |
|
PH302157 | REEP4 MS Standard C13 and N15-labeled recombinant protein (NP_079508) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review