Apoptosis enhancing nuclease (AEN) (NM_022767) Human Recombinant Protein

CAT#: TP302285

Recombinant protein of human apoptosis enhancing nuclease (AEN)

Product Images

Coomassie blue staining of purified AEN protein (Cat# TP302285). The protein was produced from HEK293T cells transfected with AEN cDNA clone (Cat# RC202285) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202285 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVPREAPESAQCLCPSLTIPNAKDVLRKRHKRRSRQHQRFMARKALLQEQGLLSMPPEPGSSPLPTPFGA
  ATATEAASSGKQCLRAGSGSAPCSRRPAPGKASGPLPSKCVAIDCEMVGTGPRGRVSELARCSIVSYHGD
  VLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQ
  TRDTTYVPNFLSEPGLHTRARVSLKDLALQLLHKKIQVGQHGHSSVEDATTAMELYRLVEVQWEQQEARS
  LWTCPEDREPDSSTDMEQYMEDQYWPDDLAHGSRGGAREAQDRRN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 36.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_073604
• Locus ID: 64782
• UniProt ID: Q8WTP8
• Cytogenetics: 15q26.1
• Refseq Size: 3134
• Refseq ORF: 975
• Synonyms: ISG20L1; pp12744
• Summary: Exonuclease with activity against single- and double-stranded DNA and RNA. Mediates p53-induced apoptosis. When induced by p53 following DNA damage, digests double-stranded DNA to form single-stranded DNA and amplifies DNA damage signals, leading to enhancement of apoptosis.[UniProtKB/Swiss-Prot Function]