SYNJ2BP (NM_018373) Human Recombinant Protein
CAT#: TP302394
Recombinant protein of human synaptojanin 2 binding protein (SYNJ2BP)
View other "SYNJ2BP" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202394 protein sequence
Red=Cloning site Green=Tags(s) MNGRVDYLVTEEEINLTRGPSGLGFNIVGGTDQQYVSNDSGIYVSRIKENGAAALDGRLQEGDKILSVNG QDLKNLLHQDAVDLFRNAGYAVSLRVQHRLQVQNGPIGHRGEGDPSGIPIFMVLVPVFALTMVAAWAFMR YRQQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 15.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_060843 |
Locus ID | 55333 |
UniProt ID | P57105, A0A024R670 |
Cytogenetics | 14q24.2 |
Refseq Size | 7074 |
Refseq ORF | 435 |
Synonyms | ARIP2; OMP25 |
Summary | Regulates endocytosis of activin type 2 receptor kinases through the Ral/RALBP1-dependent pathway and may be involved in suppression of activin-induced signal transduction.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402678 | SYNJ2BP HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402678 | Transient overexpression lysate of synaptojanin 2 binding protein (SYNJ2BP) |
USD 396.00 |
|
PH302394 | SYNJ2BP MS Standard C13 and N15-labeled recombinant protein (NP_060843) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review