TTC11 (FIS1) (NM_016068) Human Recombinant Protein
CAT#: TP302560
Recombinant protein of human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein
View other "FIS1" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 415.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202560 protein sequence
Red=Cloning site Green=Tags(s) MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQ RDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLA GLIGLAVSKSKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 16.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057152 |
Locus ID | 51024 |
UniProt ID | Q9Y3D6 |
Cytogenetics | 7q22.1 |
Refseq Size | 785 |
Refseq ORF | 456 |
Synonyms | CGI-135; TTC11 |
Summary | The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402496 | FIS1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402496 | Transient overexpression lysate of fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
USD 396.00 |
|
PH302560 | FIS1 MS Standard C13 and N15-labeled recombinant protein (NP_057152) |
USD 2,055.00 |
|
TP720888 | Purified recombinant protein of Human fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) (FIS1), nuclear gene encoding mitochondrial protein |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review