DHRS7B (NM_015510) Human Recombinant Protein

CAT#: TP302625

Recombinant protein of human dehydrogenase/reductase (SDR family) member 7B (DHRS7B)

Product Images

Coomassie blue staining of purified DHRS7B protein (Cat# TP302625). The protein was produced from HEK293T cells transfected with DHRS7B cDNA clone (Cat# RC202625) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202625 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVSPATRKSLPKVKAMDFITSTAILPLLFGCLGVFGLFRLLQWVRGKAYLRNAVVVITGATSGLGKECAK
  VFYAAGAKLVLCGRNGGALEELIRELTASHATKVQTHKPYLVTFDLTDSGAIVAAAAEILQCFGYVDILV
  NNAGISYRGTIMDTTVDVDKRVMETNYFGPVALTKALLPSMIKRRQGHIVAISSIQGKMSIPFRSAYAAS
  KHATQAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTAQGRSPVEVAQDVLAAV
  GKKKKDVILADLLPSLAVYLRTLAPGLFFSLMASRARKERKSKNS
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056325
• Locus ID: 25979
• UniProt ID: Q6IAN0
• Cytogenetics: 17p11.2
• Refseq Size: 1841
• Refseq ORF: 975
• Synonyms: CGI-93; SDR32C1
• Summary: This gene is located within the Smith-Magenis syndrome region on chromosome 17. It encodes a protein of unknown function. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Transmembrane