HES6 (NM_018645) Human Recombinant Protein
CAT#: TP303205
Recombinant protein of human hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1
View other "HES6" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203205 protein sequence
Red=Cloning site Green=Tags(s) MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRLLLAGAEVQAKLENAEVLELT VRRVQGVLRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSS FQDLLGDALAGPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEGPDLVPAALGS LTTAQIARSVWRPW myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_061115 |
Locus ID | 55502 |
UniProt ID | Q96HZ4 |
Cytogenetics | 2q37.3 |
Refseq Size | 1470 |
Refseq ORF | 672 |
Synonyms | bHLHb41; bHLHc23; C-HAIRY1; HES-6 |
Summary | This gene encodes a member of a subfamily of basic helix-loop-helix transcription repressors that have homology to the Drosophila enhancer of split genes. Members of this gene family regulate cell differentiation in numerous cell types. The protein encoded by this gene functions as a cofactor, interacting with other transcription factors through a tetrapeptide domain in its C-terminus. Alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412988 | HES6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428288 | HES6 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY412988 | Transient overexpression lysate of hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 1 |
USD 396.00 |
|
LY428288 | Transient overexpression lysate of hairy and enhancer of split 6 (Drosophila) (HES6), transcript variant 2 |
USD 396.00 |
|
PH303205 | HES6 MS Standard C13 and N15-labeled recombinant protein (NP_061115) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review