DAP13 (NDUFA12) (NM_018838) Human Recombinant Protein

CAT#: TP303265

Recombinant protein of human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 12 (NDUFA12)

Product Images

Coomassie blue staining of purified NDUFA12 protein (Cat# TP303265). The protein was produced from HEK293T cells transfected with NDUFA12 cDNA clone (Cat# RC203265) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203265 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MELVQVLKRGLQQITGHGGLRGYLRVFFRTNDAKVGTLVGEDKYGNKYYEDNKQFFGRHRWVVYTTEMNG
  KNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPLAARKFIWTNHKFNVTGTPEQYVPYSTTRKKIQEWIPP
  STPYK
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 16.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061326
• Locus ID: 55967
• UniProt ID: Q9UI09
• Cytogenetics: 12q22
• Refseq Size: 592
• Refseq ORF: 435
• Synonyms: B17.2; DAP13; MC1DN23
• Summary: This gene encodes a protein which is part of mitochondrial complex 1, part of the oxidative phosphorylation system in mitochondria. Complex 1 transfers electrons to ubiquinone from NADH which establishes a proton gradient for the generation of ATP. Mutations in this gene are associated with Leigh syndrome due to mitochondrial complex 1 deficiency. Pseudogenes of this gene are located on chromosomes 5 and 13. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2012]