MID1IP1 (NM_021242) Human Recombinant Protein

CAT#: TP303444

Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1

Product Images

Coomassie blue staining of purified MID1IP1 protein (Cat# TP303444). The protein was produced from HEK293T cells transfected with MID1IP1 cDNA clone (Cat# RC203444) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203444 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV
  PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE
  EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 20 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_067065
• Locus ID: 58526
• UniProt ID: Q9NPA3
• Cytogenetics: Xp11.4
• Refseq Size: 3795
• Refseq ORF: 549
• Synonyms: G12-like; MIG12; S14R; STRAIT11499; THRSPL
• Summary: Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).[UniProtKB/Swiss-Prot Function]