ECHDC3 (NM_024693) Human Recombinant Protein

CAT#: TP303685

Recombinant protein of human enoyl Coenzyme A hydratase domain containing 3 (ECHDC3)

Product Images

Coomassie blue staining of purified ECHDC3 protein (Cat# TP303685). The protein was produced from HEK293T cells transfected with ECHDC3 cDNA clone (Cat# RC203685) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203685 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAVAVLRAFGASGPMCLRRGPWAQLPARFCSRDPAGAGRRESEPRPTSARQLDGIRNIVLSNPKKRNTL
  SLAMLKSLQSDILHDADSNDLKVIIISAEGPVFSSGHDLKELTEEQGRDYHAEVFQTCSKVMMHIRNHPV
  PVIAMVNGLATAAGCQLVASCDIAVASDKSSFATPGVNVGLFCSTPGVALARAVPRKVALEMLFTGEPIS
  AQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLAL
  RDGQEGITAFLQKRKPVWSHEPV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 32.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_078969
• Locus ID: 79746
• UniProt ID: Q96DC8, A0A140VKF9
• Cytogenetics: 10p14
• Refseq Size: 1674
• Refseq ORF: 909
• Summary: May play a role in fatty acid biosynthesis and insulin sensitivity.[UniProtKB/Swiss-Prot Function]