RTDR1 (RSPH14) (NM_014433) Human Recombinant Protein

CAT#: TP303725

Recombinant protein of human rhabdoid tumor deletion region gene 1 (RTDR1)

Product Images

Coomassie blue staining of purified RSPH14 protein (Cat# TP303725). The protein was produced from HEK293T cells transfected with RSPH14 cDNA clone (Cat# RC203725) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC203725 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMALCDLMHDPECIYKAMNIGCME
  NLKALLKDSNSMVRIKTTEVLHITASHSVGRYAFLEHDIVLALSFLLNDPSPVCRGNLYKAYMQLVQVPR
  GAQEIISKGLISSLVWKLQVEVEEEEFQEFILDTLVLCLQEDATEALGSNVVLVLKQKLLSANQNIRSKA
  ARALLNVSISREGKKQVCHFDVIPILVHLLKDPVEHVKSNAAGALMFATVITEGKYAALEAQAIGLLLEL
  LHSPMTIARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAARIAISVIEFKP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 38.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055248
• Locus ID: 27156
• UniProt ID: Q9UHP6
• Cytogenetics: 22q11.22-q11.23
• Refseq Size: 1286
• Refseq ORF: 1044
• Synonyms: RTDR1
• Summary: This gene encodes a protein with no known function but with slight similarity to a yeast vacuolar protein. The gene is located in a region deleted in pediatric rhabdoid tumors of the brain, kidney and soft tissues, but mutations in this gene have not been associated with the disease. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome