IGFBP4 (NM_001552) Human Recombinant Protein
CAT#: TP304188
Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4)
View other "IGFBP4" proteins (5)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204188 protein sequence
Red=Cloning site Green=Tags(s) MLPLCLVAALLLAAGPGPSLGDEAIHCPPCSEEKLARCRPPVGCEELVREPGCGCCATCALGLGMPCGVY TPRCGSGLRCYPPRGVEKPLHTLMHGQGVCMELAEIEAIQESLQPSDKDEGDHPNNSFSPCSAHDRRCLQ KHFAKIRDRSTSGGKMKVNGAPREDARPVPQGSCQSELHRALERLAASQSRTHEDLYIIPIPNCDRNGNF HPKQCHPALDGQRGKCWCVDRKTGVKLPGGLEPKGELDCHQLADSFRE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001543 |
Locus ID | 3487 |
UniProt ID | P22692, A0A024R1U8 |
Cytogenetics | 17q21.2 |
Refseq Size | 2246 |
Refseq ORF | 774 |
Synonyms | BP-4; HT29-IGFBP; IBP4; IGFBP-4 |
Summary | This gene is a member of the insulin-like growth factor binding protein (IGFBP) family and encodes a protein with an IGFBP domain and a thyroglobulin type-I domain. The protein binds both insulin-like growth factors (IGFs) I and II and circulates in the plasma in both glycosylated and non-glycosylated forms. Binding of this protein prolongs the half-life of the IGFs and alters their interaction with cell surface receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419861 | IGFBP4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY419861 | Transient overexpression lysate of insulin-like growth factor binding protein 4 (IGFBP4) |
USD 396.00 |
|
PH304188 | IGFBP4 MS Standard C13 and N15-labeled recombinant protein (NP_001543) |
USD 2,055.00 |
|
TP720301 | Recombinant protein of human insulin-like growth factor binding protein 4 (IGFBP4) |
USD 330.00 |
|
TP723172 | Purified recombinant protein of Human insulin-like growth factor binding protein 4 (IGFBP4). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review