NT5C3L (NT5C3B) (NM_052935) Human Recombinant Protein
CAT#: TP304354
Recombinant protein of human 5'-nucleotidase, cytosolic III-like (NT5C3L)
View other "NT5C3B" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204354 protein sequence
Red=Cloning site Green=Tags(s) MKATVLMRQPGRVQEIVGALRKGGGDRLQVISDFDMTLSRFAYNGKRCPSSYNILDNSKIISEECRKELT ALLHHYYPIEIDPHRTVKEKLPHMVEWWTKAHNLLCQQKIQKFQIAQVVRESNAMLREGYKTFFNTLYHN NIPLFIFSAGIGDILEEIIRQMKVFHPNIHIVSNYMDFNEDGFLQGFKGQLIHTYNKNSSVCENCGYFQQ LEGKTNVILLGDSIGDLTMADGVPGVQNILKIGFLNDKVEERRERYMDSYDIVLEKDETLDVVNGLLQHI LCQGVQLEMQGP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 34.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_443167 |
Locus ID | 115024 |
UniProt ID | Q969T7 |
Cytogenetics | 17q21.2 |
Refseq Size | 1430 |
Refseq ORF | 876 |
Synonyms | cN-IIIB; NT5C3L |
Summary | Specifically hydrolyzes 7-methylguanosine monophosphate (m(7)GMP) to 7-methylguanosine and inorganic phosphate (PubMed:23223233, PubMed:24603684). The specific activity for m(7)GMP may protect cells against undesired salvage of m(7)GMP and its incorporation into nucleic acids (PubMed:23223233). Also has weak activity for CMP (PubMed:23223233, PubMed:24603684). UMP and purine nucleotides are poor substrates (PubMed:23223233).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409391 | NT5C3B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY409391 | Transient overexpression lysate of 5'-nucleotidase, cytosolic III-like (NT5C3L) |
USD 396.00 |
|
PH304354 | NT5C3L MS Standard C13 and N15-labeled recombinant protein (NP_443167) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review