Tropomodulin 4 (TMOD4) (NM_013353) Human Recombinant Protein
CAT#: TP304673
Recombinant protein of human tropomodulin 4 (muscle) (TMOD4)
View other "TMOD4" proteins (3)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC204673 protein sequence
Red=Cloning site Green=Tags(s) MSSYQKELEKYRDIDEDEILRTLSPEELEQLDCELQEMDPENMLLPAGLRQRDQTKKSPTGPLDREALLQ YLEQQALEVKERDDLVPFTGEKKGKPYIQPKREIPAEEQITLEPELEEALAHATDAEMCDIAAILDMYTL MSNKQYYDALCSGEICNTEGISSVVQPDKYKPVPDEPPNPTNIEEILKRVRSNDKELEEVNLNNIQDIPI PMLSELCEAMKANTYVRSFSLVATRSGDPIANAVADMLRENRSLQSLNIESNFISSTGLMAVLKAVRENA TLTELRVDNQRQWPGDAVEMEMATVLEQRPSIVRFGYHFTQQGPRARAAQAMTRNNELRRQQKKR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.2 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037485 |
Locus ID | 29765 |
UniProt ID | Q9NZQ9 |
Cytogenetics | 1q21.3 |
Refseq Size | 1322 |
Refseq ORF | 1035 |
Synonyms | SK-TMOD |
Summary | Blocks the elongation and depolymerization of the actin filaments at the pointed end. The Tmod/TM complex contributes to the formation of the short actin protofilament, which in turn defines the geometry of the membrane skeleton.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415656 | TMOD4 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY415656 | Transient overexpression lysate of tropomodulin 4 (muscle) (TMOD4) |
USD 396.00 |
|
PH304673 | TMOD4 MS Standard C13 and N15-labeled recombinant protein (NP_037485) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review