Apolipoprotein M (APOM) (NM_019101) Human Recombinant Protein

CAT#: TP304679

Recombinant protein of human apolipoprotein M (APOM)

Product Images

Coomassie blue staining of purified APOM protein (Cat# TP304679). The protein was produced from HEK293T cells transfected with APOM cDNA clone (Cat# RC204679) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204679 representing NM_019101
  Red=Cloning site Green=Tags(s)
  
  MFHQIWAALLYFYGIILNSIYQCPEHSQLTTLGVDGKEFPEVHLGQWYFIAGAAPTKEELATFDPVDNIV
  FNMAAGSAPMQLHLRATIRMKDGLCVPRKWIYHLTEGSTDLRTEGRPDMKTELFSSSCPGGIMLNETGQG
  YQRFLLYNRSPHPPEKCVEEFKSLTSCLDSKAFLLTPRNQEACELSNN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_061974
• Locus ID: 55937
• UniProt ID: O95445
• Cytogenetics: 6p21.33
• Refseq Size: 790
• Refseq ORF: 564
• Synonyms: apo-M; G3a; HSPC336; NG20
• Summary: The protein encoded by this gene is an apolipoprotein and member of the lipocalin protein family. It is found associated with high density lipoproteins and to a lesser extent with low density lipoproteins and triglyceride-rich lipoproteins. The encoded protein is secreted through the plasma membrane but remains membrane-bound, where it is involved in lipid transport. Alternate splicing results in both coding and non-coding variants of this gene. [provided by RefSeq, Jan 2012]
• Protein Families: Secreted Protein