HMGA1 (NM_145903) Human Recombinant Protein
CAT#: TP304972
Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 5
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC204972 protein sequence
Red=Cloning site Green=Tags(s) MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGR KPRGRPKKLEKEEEEGISQESSEEEQ myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 10.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_665910 |
| Locus ID | 3159 |
| UniProt ID | P17096, Q5T6U8 |
| Cytogenetics | 6p21.31 |
| Refseq Size | 1884 |
| Refseq ORF | 288 |
| Synonyms | HMG-R; HMGA1A; HMGIY |
| Summary | This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes. [provided by RefSeq, Jan 2016] |
| Protein Families | Druggable Genome, Stem cell - Pluripotency, Stem cell relevant signaling - JAK/STAT signaling pathway, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407836 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407837 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407838 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407839 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407840 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC407841 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419517 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430161 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430162 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430164 | HMGA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY407836 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
USD 436.00 |
|
| LY407837 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 |
USD 436.00 |
|
| LY407838 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 436.00 |
|
| LY407839 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 5 |
USD 436.00 |
|
| LY407840 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 6 |
USD 436.00 |
|
| LY407841 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 436.00 |
|
| LY419517 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 2 |
USD 436.00 |
|
| LY430161 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 3 |
USD 396.00 |
|
| LY430162 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 396.00 |
|
| LY430164 | Transient overexpression lysate of high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 396.00 |
|
| PH301458 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_002122) |
USD 2,055.00 |
|
| PH302928 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665906) |
USD 2,055.00 |
|
| PH304972 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665910) |
USD 2,055.00 |
|
| PH313109 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665909) |
USD 2,055.00 |
|
| PH317302 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665911) |
USD 2,055.00 |
|
| PH317358 | HMGA1 MS Standard C13 and N15-labeled recombinant protein (NP_665912) |
USD 2,055.00 |
|
| TP301458 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 2 |
USD 823.00 |
|
| TP302928 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 1 |
USD 823.00 |
|
| TP313109 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 4 |
USD 748.00 |
|
| TP317302 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 6 |
USD 748.00 |
|
| TP317358 | Recombinant protein of human high mobility group AT-hook 1 (HMGA1), transcript variant 7 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China