PHYHIP (NM_014759) Human Recombinant Protein

CAT#: TP305205

Recombinant protein of human phytanoyl-CoA 2-hydroxylase interacting protein (PHYHIP), transcript variant 2


  View other "PHYHIP" proteins (9)

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

USD 823.00

In Stock*

Size
    • 20 ug

Product Images

Frequently bought together (2)
Rabbit Polyclonal Anti-PHYHIP Antibody
    • 100 ul

USD 310.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00

Other products for "PHYHIP"

Specifications

Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>RC205205 protein sequence
Red=Cloning site Green=Tags(s)

MELLSTPHSIEINNITCDSFSISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPM
TVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVF
YRNHHKEYFEHARTHCGNMLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPA
QRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSMGDRFCRDRRPLLDIACNKFLTCSVEDGELVFRHAQ
DLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 37.4 kDa
Concentration >50 ug/mL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_055574
Locus ID 9796
UniProt ID Q92561
Cytogenetics 8p21.3
Refseq Size 3232
Refseq ORF 990
Synonyms DYRK1AP3; PAHX-AP; PAHXAP1
Summary Its interaction with PHYH suggests a role in the development of the central system.[UniProtKB/Swiss-Prot Function]

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.