AGXT2L1 (ETNPPL) (NM_031279) Human Recombinant Protein

CAT#: TP305429

Recombinant protein of human alanine-glyoxylate aminotransferase 2-like 1 (AGXT2L1)

Product Images

Coomassie blue staining of purified ETNPPL protein (Cat# TP305429). The protein was produced from HEK293T cells transfected with ETNPPL cDNA clone (Cat# RC205429) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC205429 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MCELYSKRDTLGLRKKHIGPSCKVFFASDPIKIVRAQRQYMFDENGEQYLDCINNVAHVGHCHPGVVKAA
  LKQMELLNTNSRFLHDNIVEYAKRLSATLPEKLSVCYFTNSGSEANDLALRLARQFRGHQDVITLDHAYH
  GHLSSLIEISPYKFQKGKDVKKEFVHVAPTPDTYRGKYREDHADSASAYADEVKKIIEDAHNSGRKIAAF
  IAESMQSCGGQIIPPAGYFQKVAEYVHGAGGVFIADEVQVGFGRVGKHFWSFQMYGEDFVPDIVTMGKPM
  GNGHPVACVVTTKEIAEAFSSSGMEYFNTYGGNPVSCAVGLAVLDIIENEDLQGNAKRVGNYLTELLKKQ
  KAKHTLIGDIRGIGLFIGIDLVKDHLKRTPATAEAQHIIYKMKEKRVLLSADGPHRNVLKIKPPMCFTEE
  DAKFMVDQLDRILTVLEEAMGTKTESVTSENTPCKTKMLKEAHIELLRDSTTDSKENPSRKRNGMCTDTH
  SLLSKRLKT
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 55.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_112569
• Locus ID: 64850
• UniProt ID: Q8TBG4
• Cytogenetics: 4q25
• Refseq Size: 2133
• Refseq ORF: 1497
• Synonyms: AGXT2L1
• Summary: Catalyzes the pyridoxal-phosphate-dependent breakdown of phosphoethanolamine, converting it to ammonia, inorganic phosphate and acetaldehyde.[UniProtKB/Swiss-Prot Function]
• Protein Families: Druggable Genome